Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter acinonychis ATP synthase subunit a (atpB)

This Recombinant Helicobacter acinonychis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q17WM4

Expression Region

1-226

Origin

Helicobacter acinonychis (strain Sheeba)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHRVFTVANFFSSNHDFITGFFVVLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAI LSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPSFESPTASWSFTLVLALIVFFYY HFEGIRVQGFFKYFAHFAGPVKWLAPFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLI MLLLVPWVIPVAPFMVLFFMGILQAFVFMILTYVYLAGAVLTDEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB500140 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Recombinant Mouse EphA1 Protein (His Tag)
PKSM040465 100 µg

Recombinant Mouse EphA1 Protein (His Tag)

Sign In for Pricing
View Details
Amyloid beta A4 protein / APP (433-452) Chicken Polyclonal Antibody
AP33337PU-N 1 mL

Amyloid beta A4 protein / APP (433-452) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
XRCC3 Rabbit Polyclonal Antibody
AP06482PU-N 100 µg

XRCC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), Biotin conjugate, 0.1mg/mL
BNCB1870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AccuGreenTM Standard 2, 10 ng/uL
#99820-T 1x 1 mL

AccuGreenTM Standard 2, 10 ng/uL

Sign In for Pricing
View Details