Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori ATP synthase subunit a (atpB)

This Recombinant Helicobacter pylori ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1CT41

Expression Region

1-226

Origin

Helicobacter pylori (strain HPAG1)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHRVFTIANFFSSNHDFITGFFVVLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAI LSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPGFESPTASWSFTLVLALIVFFYY HFEGIRVQGFFKYFAHFAGPVKWLAPFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLI MLLLVPWAVPVAPFMVLFFMGILQAFVFMILTYVYLAGAVLTDEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/2580), CF647 conjugate, 0.1mg/mL
BNC472580-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2580), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FASTKD5 Rabbit Polyclonal Antibody
TA364791 100 µL

FASTKD5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS633994 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
1-Undecanol
TRC-U788800-5G 5 g

1-Undecanol

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF568 conjugate, 0.1mg/mL
BNC681199-100 1x 100 µL

SUMO-2 (SUMO2/1199), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR Recombinant Rabbit monoclonal Antibody
HA750550 100 µL

EGFR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details