Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig ATP synthase subunit a (MT-ATP6)

This Recombinant Pig ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q35915

Expression Region

1-226

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENLFASFIAPTMMGLPIVTLIIMFPSLLFPTPKRLINNRTISIQQWLIQLTSKQMMAI HNQKGQTWSLMLMSLIMFIGSTNILGLLPHSFTPTTQLSMNLGMAIPLWSATVFTGFRYK TKTSLAHFLPQGTPALLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLA LLNINTMTAFITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 (NM_000304) Human Over-expression Lysate
LY424810 100 µg

PMP22 (NM_000304) Human Over-expression Lysate

Sign In for Pricing
View Details
Ultrasonic Homogenizer BLIH-304
BLIH-304 1 Unit

Ultrasonic Homogenizer BLIH-304

Sign In for Pricing
View Details
Tissue Total RNA, Metastasis, unknown source
CR559800 5 µg

Tissue Total RNA, Metastasis, unknown source

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR561054 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
c Abl (ABL1) Human Gene Knockout Kit (CRISPR)
KN420556 1 Kit

c Abl (ABL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Cyano-3,3-diphenylacrylic Acid
TRC-C979373-500MG 500 mg

2-Cyano-3,3-diphenylacrylic Acid

Sign In for Pricing
View Details