Recombinant Lemur catta ATP synthase subunit a (MT-ATP6)
This Recombinant Lemur catta ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.
Product Specifications
Product Name Alternative
ATP synthase subunit a, F-ATPase protein 6
UniProt
Q8LX27
Expression Region
1-226
Origin
Lemur catta (Ring-tailed lemur)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNENLFASFITPTIVGIPIVILIIMTPYIIFPSPTRLINNRLTSLQQWLVQLILKQLMSI HNTKGRTWSLMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAATVIKGFRHK TKASLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV LTSISPATASITFIILTLLTILEFAVALIQAYVFTLLVSLYLHDNT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680409-100 1x 100 µL
UPK3A (Uroplakin 3A) (Rabbit PAb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471815-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details