Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bos indicus ATP synthase subunit a (MT-ATP6)

This Recombinant Bos indicus ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q8LTZ5

Expression Region

1-226

Origin

Bos indicus (Zebu)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENLFASFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSI HNSKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNK TKASLAHFLPQGTPTPLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLA LMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flutazolam
TRC-F599405-50MG 50 mg

Flutazolam

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), CF594 conjugate, 0.1mg/mL
BNC942496-500 1x 500 µL

CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: sigmoid
CP565911 150 µg

Tissue Protein Lysate, Colon: sigmoid

Sign In for Pricing
View Details
SMPX Antibody
KC-33287-01 50 μL

SMPX Antibody

Sign In for Pricing
View Details
SMPX Antibody
KC-33287-02 100 µL

SMPX Antibody

Sign In for Pricing
View Details
SMPX Antibody
KC-33287-03 1 mL

SMPX Antibody

Sign In for Pricing
View Details