Recombinant Pan troglodytes ATP synthase subunit a (MT-ATP6)
This Recombinant Pan troglodytes ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.
Product Specifications
Product Name Alternative
ATP synthase subunit a, F-ATPase protein 6
UniProt
Q9T9W0
Expression Region
1-226
Origin
Pan troglodytes (Chimpanzee)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNENLFASFAAPTILGLPAAVLIILFPPLLVPTSKHLINNRLITTQQWLIQLTSKQMMTM HSTKGRTWSLMLVSLIIFITTTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGAVVMGFRFK TKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA LSTINLPYALIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682145-500 1x 500 µL
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042644-500 1x 500 µL
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682884-100 1x 100 µL
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741482-500 1x 500 µL
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details