Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat ATP synthase subunit a (MT-ATP6)

This Recombinant Cat ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P48894

Expression Region

1-226

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENLFASFTTPTMMGLPIVILIIMFPSILFPSPNRLINNRLVSLQQWLVQLTSKQMLAI HNHKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHK TKASLAHFLPQGTPVPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLMHLIGGAALA LMNISTSIALITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF405S conjugate, 0.1mg/mL
BNC043006-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS711793 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
Recombinant Human Cystatin C/CST3 Protein (His Tag)
PKSH031605-01 100 µg

Recombinant Human Cystatin C/CST3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cystatin C/CST3 Protein (His Tag)
PKSH031605-02 1 mg

Recombinant Human Cystatin C/CST3 Protein (His Tag)

Sign In for Pricing
View Details
MAGEA3 Antibody
KC-13117-01 50 μL

MAGEA3 Antibody

Sign In for Pricing
View Details
MAGEA3 Antibody
KC-13117-02 100 µL

MAGEA3 Antibody

Sign In for Pricing
View Details