Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii ATP synthase subunit a (MT-ATP6)

This Recombinant Pongo abelii ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P92695

Expression Region

1-226

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESLFTPFITPTVLGLPAAVLVILFPPLLIPTSKHLINNRLIIIQQWLIRLILKQMMTT HNAKGRTWSLMLTSLIIFIASTNLLGLLPYSFTPTTQLSMNLAMAIPLWASTVAMGLRFK AKITLTHLLPQGTPTPLIPMLIIIETVSLFIQPLALAVRLTANITAGHLLMHLIGSSALA MLAINLPLTLITLTILTLLTILETAIALIQAYVFTLLVSLYLHDNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galeopsin
TN4093 5 mg

Galeopsin

Sign In for Pricing
View Details
Olr1316 sgRNA CRISPR Lentivector set (Rat)
K7348101 3x 1.0 µg

Olr1316 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Anti-Inhibin beta A antibody
SL1774R-01 50 µL

Rabbit Anti-Inhibin beta A antibody

Sign In for Pricing
View Details
Rabbit Anti-Inhibin beta A antibody
SL1774R-02 100 µL

Rabbit Anti-Inhibin beta A antibody

Sign In for Pricing
View Details
BALB/c Mouse Brain Vascular Fibroblasts
ABC-TC3062 1 Vial

BALB/c Mouse Brain Vascular Fibroblasts

Sign In for Pricing
View Details
ADORA2B Antibody
8111-01mg 0.1 mg

ADORA2B Antibody

Sign In for Pricing
View Details