Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macropus robustus ATP synthase subunit a (MT-ATP6)

This Recombinant Macropus robustus ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P92664

Expression Region

1-226

Origin

Macropus robustus (Wallaroo) (Euro)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENLFATFITPTILGITTLPIIMLFPCLLLTSPKRWLPNRIQILQVWLIRLITKQMLTI HNKQGRSWALMLMSLILFIASTNLLGLLPYSFTPTTQLSMNIGMAIPLWLATVLMGFRNK PKISLAHFLPQGTPTPLVPMLIIIETISLFIQPVALAVRLTANITAGHLLIHLIGSATLA LCSISVTVSTITFIILFLLTILELAVAMIQAYVFTLLVSLYLHDNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casirivimab Biosimilar - Research Grade
ICH5200-1mg 1 mg

Casirivimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Slc3a2 Mouse Gene Knockout Kit (CRISPR)
KN516115 1 Kit

Slc3a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2-Bis-(4-hydroxyphenyl)hexafluoropropane Monosulfate Sodium Salt
TRC-B446685-50MG 50 mg

2,2-Bis-(4-hydroxyphenyl)hexafluoropropane Monosulfate Sodium Salt

Sign In for Pricing
View Details
HRP Conjugated Laburnum anagyroides Lectin (Gold Chain) -LAL-
H-8101-1 1 mg

HRP Conjugated Laburnum anagyroides Lectin (Gold Chain) -LAL-

Sign In for Pricing
View Details
C1QTNF12 Human Gene Knockout Kit (CRISPR)
KN423004 1 Kit

C1QTNF12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR562474 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details