Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macropus robustus ATP synthase subunit a (MT-ATP6)

This Recombinant Macropus robustus ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P92664

Expression Region

1-226

Origin

Macropus robustus (Wallaroo) (Euro)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENLFATFITPTILGITTLPIIMLFPCLLLTSPKRWLPNRIQILQVWLIRLITKQMLTI HNKQGRSWALMLMSLILFIASTNLLGLLPYSFTPTTQLSMNIGMAIPLWLATVLMGFRNK PKISLAHFLPQGTPTPLVPMLIIIETISLFIQPVALAVRLTANITAGHLLIHLIGSATLA LCSISVTVSTITFIILFLLTILELAVAMIQAYVFTLLVSLYLHDNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3493), CF594 conjugate, 0.1mg/mL
BNC943493-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3493), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human JNK1/MAPK8 Protein (GST Tag)
PKSH031427 50 µg

Recombinant Human JNK1/MAPK8 Protein (GST Tag)

Sign In for Pricing
View Details
RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL
BNC742929-100 1x 100 µL

RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (S100B/1012), Biotin conjugate, 0.1mg/mL
BNCB1012-100 1x 100 µL

S100B (S100B/1012), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDw17 (H018.3G-6.F5), 0.2mg/mL
BNUB1092-100 1x 100 µL

CDw17 (H018.3G-6.F5), 0.2mg/mL

Sign In for Pricing
View Details
KIRREL2 Polyclonal Antibody
E-AB-66011-01 60 µL

KIRREL2 Polyclonal Antibody

Sign In for Pricing
View Details