Recombinant Balaenoptera musculus ATP synthase subunit a (MT-ATP6)
This Recombinant Balaenoptera musculus ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.
Product Specifications
Product Name Alternative
ATP synthase subunit a, F-ATPase protein 6
UniProt
P41291
Expression Region
1-226
Origin
Balaenoptera musculus (Blue whale)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNENLFAPFMIPVMLGIPITTLIIILPSILFPAPNRLINNRTISIQQWLTKLTSKQLMSV HSPKGQTWSLMLISLFLFIASTNLLGMLPHSFTPTTQLSMNVGMAIPLWAGTVATGFRNK TKMSLAHLLPQGTPTFLIPMLVIIETISLFIQPVALAVRLTANITAGHLLMHLIGETTLV LMSTSLFTAIITFTILALLTILEFRVALIQAYVFTLLVSLYLHDNT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401045-500 1x 500 µL
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400012-500 1x 500 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741773-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details