Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 ATP synthase subunit a (atpB)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1W0I8

Expression Region

1-226

Origin

Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVPRGMQNLGEAFLEGVL SMGRDTMGSEKGARKYLPLVATLGIIVFFSNIIGIIPGFHSPTASLNLTLSLAIIVFVYY HFEGIRAQGFVKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMV ILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVVEEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL
BNC882809-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL
BNC681931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF640R conjugate, 0.1mg/mL
BNC401782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF640R conjugate, 0.1mg/mL
BNC401097-500 1x 500 µL

CD44 Standard (HCAM/1097), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (BAX/962), CF640R conjugate, 0.1mg/mL
BNC400962-100 1x 100 µL

Bax (BAX/962), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details