Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. doylei ATP synthase subunit a (atpB)

This Recombinant Campylobacter jejuni subsp. doylei ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A7H2H4

Expression Region

1-226

Origin

Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVPRGMQNLAEAFLEGVL SMGRDTMGSEKGVRKYLPLVATLGIIVFFSNIIGILPGFHAPTASLNLTLSLAIIVFVYY HFEGIRAQGFIKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMV ILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVVEKGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP6AP1L activation kit by CRISPRa
GA114196 1 Kit

Human ATP6AP1L activation kit by CRISPRa

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2641-01 50 μL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2641-02 100 µL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2641-03 1 mL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Rat CCL2/JE/MCP-1 Protein (Trx Tag)
PDER100141-01 20 µg

Recombinant Rat CCL2/JE/MCP-1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Rat CCL2/JE/MCP-1 Protein (Trx Tag)
PDER100141-02 100 µg

Recombinant Rat CCL2/JE/MCP-1 Protein (Trx Tag)

Sign In for Pricing
View Details