Recombinant Danio rerio ATP synthase subunit a (mt-atp6)
This Recombinant Danio rerio ATP synthase subunit a (mt-atp6) spans the amino acid sequence from region 1-227.
Product Specifications
Product Name Alternative
ATP synthase subunit a, F-ATPase protein 6
UniProt
Q9MIY5
Expression Region
1-227
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MMTSFFDQFASPYLLGIPLILVAMLLPWLLFPAPTSRWINNRLITVQTWLTGRFTNQLMT PLNFSGHKWALLFASLMVFLITINLLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMKN QPTIALGHLLPEGTPIPLIPALIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVF VLLPMMPAVAILTASVLFLLTLLEVAVAMIQAYVFILLLSLYLQENI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042341-500 1x 500 µL
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040688-100 1x 100 µL
Cytokeratin 8 (C-43), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472044-500 1x 500 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details