Recombinant Anas platyrhynchos ATP synthase subunit a (MT-ATP6)
This Recombinant Anas platyrhynchos ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-227.
Product Specifications
Product Name Alternative
ATP synthase subunit a, F-ATPase protein 6
UniProt
P50654
Expression Region
1-227
Origin
Anas platyrhynchos (Domestic duck) (Anas boschas)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLSFFDQFSSPHLLGHPLILLSLLLPALLFPSPGNRWINNRLSTIQLWLLHLITKQLMI PLNKNGHKWALMLTSLMTMLLTINLLGLLPYTFTPTTQLSMNMALAFPLWLATLLTGLRN KPSASLAHLLPEGTPTPLIPALILIETTSLLIRPLALGVRLTANLTAGHLLIQLISTASI ALKPILPTVSILTMAILLLLTILEVAVAMIQAYVFVLLLSLYLQENI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741081-500 1x 500 µL
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 