Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Struthio camelus ATP synthase subunit a (MT-ATP6)

This Recombinant Struthio camelus ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

O21402

Expression Region

1-227

Origin

Struthio camelus (Ostrich)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLSFFDQFASPQLLGIPLILLSLLFPTLLLPSPNNRWINNRLSTLQLWFLQLITKQLMM PLNKAGHKWALILTSLMTFLLLINLLGLLPYTFTPTTQLSMNMALAFPLWLATLLTGLRN QPSISLGHLLPEGTPTPLIPALILIETTSLLIRPLALGVRLTANLTAGHLLIQLISTATL ALLPTMPTISVLTATVLLLLTILELAVAMIQAYVFVLLLSLYLQENI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS503999 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CD43 (SPN/839), 0.2mg/mL
BNUB0839-100 1x 100 µL

CD43 (SPN/839), 0.2mg/mL

Sign In for Pricing
View Details
PXMP2 Antibody
8C17632-AAT 50 µg

PXMP2 Antibody

Sign In for Pricing
View Details
PML Protein (PML) (Sumoylation Site) Rabbit Polyclonal Antibody
AP12217PU-N 400 µL

PML Protein (PML) (Sumoylation Site) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ttc12 Mouse Gene Knockout Kit (CRISPR)
KN518393 1 Kit

Ttc12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cbfa2t2 Mouse Gene Knockout Kit (CRISPR)
KN502592 1 Kit

Cbfa2t2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details