Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Electron transport complex protein RnfE (rnfE)

This Recombinant Cronobacter sakazakii Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A7MML2

Expression Region

1-228

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDVKSILVNGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNASISAFR RWMPGEIRIPIYVMIIAAVVSIVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KNGPLLSALDGFAIGLGATGAMFVLGSLREILGNGTLFDGADGLLGSWARVLRIEVFHTD TPFLLAMLPPGAFIGLGMMLAVKYLIDERMKRRAAKPVVVEAAAEKAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Collagen Type III (COL3) ELISA Kit
orb782050-01 48 Tests

Horse Collagen Type III (COL3) ELISA Kit

Sign In for Pricing
View Details
Horse Collagen Type III (COL3) ELISA Kit
orb782050-02 96 Tests

Horse Collagen Type III (COL3) ELISA Kit

Sign In for Pricing
View Details
5-Methyl-2- (methylthio) pyridine-3-boronic acid
OR1087378 1 Each

5-Methyl-2- (methylthio) pyridine-3-boronic acid

Sign In for Pricing
View Details
Human anti-human IL-12 mAb (AB26)
E4A09D20-AB26 100 µg

Human anti-human IL-12 mAb (AB26)

Sign In for Pricing
View Details
Anti Loterprendol Pab Rat
150182 100 µg

Anti Loterprendol Pab Rat

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Transaldolase (tal)
MBS1160611-01 0.02 mg (E-Coli)

Recombinant Shewanella pealeana Transaldolase (tal)

Sign In for Pricing
View Details