Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Rickettsia typhi Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q68WV5

Expression Region

1-228

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITQKEKEHLAKDKQNIYLRIISGIVLVSLFVVAILWFKTLFYILMILVGLGMLSEWCNM TSSSIHYLLIGFIIIPIPISLLIFLSTQESNRLVIMLYFCIIWSVDTFAMIGGKTFKGTK LAPKISPKKTWTGLIIGTISAGLIAVLVSLIPYYHIENYYFSNKIYLFIISCILALIAQS SDLFISYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVFFGINIYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF405S conjugate, 0.1mg/mL
BNC042039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DIS3 Antibody
KC-45675-01 50 μL

DIS3 Antibody

Sign In for Pricing
View Details
DIS3 Antibody
KC-45675-02 100 µL

DIS3 Antibody

Sign In for Pricing
View Details
DIS3 Antibody
KC-45675-03 1 mL

DIS3 Antibody

Sign In for Pricing
View Details
ST14 (N-term) Rabbit Polyclonal Antibody
AP23643PU-N 50 µL

ST14 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF568 conjugate, 0.1mg/mL
BNC682291-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details