What is the catalog number for Recombinant Lysine exporter protein (lysE)?

The catalog number for Recombinant Lysine exporter protein (lysE) is orb2912155.

What sizes are available for Recombinant Lysine exporter protein (lysE)?

Recombinant Lysine exporter protein (lysE) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Lysine exporter protein (lysE) come in?

Recombinant Lysine exporter protein (lysE) is available in 2 different pack sizes.

Is Recombinant Lysine exporter protein (lysE) in stock?

Recombinant Lysine exporter protein (lysE) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Lysine exporter protein (lysE)

This Recombinant Lysine exporter protein (lysE) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Lysine exporter protein

UniProt

Q8RQM4

Expression Region

1-228

Origin

Corynebacterium efficiens

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIFVTGLLLGASLLLAIGPQNVLVIKQGIKREGITAVIIVCLLSDVVLFTLGTLGVGLI SDTAPIILDILRWCGIAYLLWFAVMAARDALRARTEVTFVEHSEPVAAASASGGGVTTKQ RPRLRITSGTRQVWVRPMLMAIVLTWLNPNAYLDAFVFIGGVGAQYGETGRWIFAAGAFA ASLVWFPLVGYGAAALSRPLSSPRVWRWINIGVAVVLTGLAVKLILMG