Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Myxine glutinosa ATP synthase subunit a (MT-ATP6)

This Recombinant Myxine glutinosa ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

O63912

Expression Region

1-228

Origin

Myxine glutinosa (Atlantic hagfish)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMMSLFNTFESPYFLGFPLMIFIAILISLTMFIPDNNLLIKNQSSMLASTFLKTMTKEIF SPIKKSGHSWALLLMTTLMFIFLNNITGLLPYTFTVTSQLSLNMAMAIPLWLGTIIMGAT SQPSHSLAHLLPEGTPMTLAPFLIVIESISIIIRPLALGVRLTANITAGHLLIHLVSLAL INLTKSLPLLFLTFSVFILLLILELAVSFIQAYVFVMLVSLYLEENLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL
BNC942266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF647 conjugate, 0.1mg/mL
BNC472266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/1094), CF647 conjugate, 0.1mg/mL
BNC471094-100 1x 100 µL

CD43 (SPN/1094), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400375-100 1x 100 µL

P40 (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details