Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)

This Recombinant Staphylococcus aureus Holin-like protein CidB (cidB) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Holin-like protein CidB

UniProt

P60640

Expression Region

1-229

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GNAQ Antibody
RC-4832-01 50 μL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details
Recombinant GNAQ Antibody
RC-4832-02 100 µL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details
Recombinant GNAQ Antibody
RC-4832-03 1 mL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right middle lobe
CS648056 5x 5 µm

Frozen Tissue Sections, Lung: right middle lobe

Sign In for Pricing
View Details
Cortisone-d8 (Major)
TRC-C696502-25MG 25 mg

Cortisone-d8 (Major)

Sign In for Pricing
View Details
Polystyrene A Br
HA16020001.100G 100 g

Polystyrene A Br

Sign In for Pricing
View Details