Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)

This Recombinant Staphylococcus aureus Holin-like protein CidB (cidB) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Holin-like protein CidB

UniProt

P60638

Expression Region

1-229

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EIF2AK2 (Thr446) Antibody
A53367-100UL 100 µL

Phospho-EIF2AK2 (Thr446) Antibody

Sign In for Pricing
View Details
Recombinant Cocal virus Glycoprotein G (G)
MBS1255937 Inquire

Recombinant Cocal virus Glycoprotein G (G)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
TRV-0004059-01 10 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
TRV-0004059-02 50 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
TRV-0004059-03 100 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
TRV-0004059-04 200 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details