Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus ATP synthase subunit a 1 (atpB1)

This Recombinant Pelobacter propionicus ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

A1ALL0

Expression Region

1-229

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPLLFLEFFRKLLEPLHMSEAGADAVAYTWLIMLLLLLFSFLATRALKMIPCGLQNFM EVVVGGVENMIVETMGEHGRPYFPLVATVGLFVLVSNLIGLIPGFFPPTANINTTAACAI VVFIATHVVGIKRHGIGYIKHFCGPILWLAPVMFFIEVIGHLSRPLSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TFPI Antibody (Marstacimab)
F1746-.1 100 µg

Anti-TFPI Antibody (Marstacimab)

Sign In for Pricing
View Details
Influenza A H3N2 (A/Christchurch/4/1985) Hemagglutinin / HA1 Protein (His Tag)
PO54338M2 100 µg

Influenza A H3N2 (A/Christchurch/4/1985) Hemagglutinin / HA1 Protein (His Tag)

Sign In for Pricing
View Details
SLC17A7 Antibody
MBS8595962-01 0.1 mg

SLC17A7 Antibody

Sign In for Pricing
View Details
SLC17A7 Antibody
MBS8595962-02 0.1 mL (AF405L)

SLC17A7 Antibody

Sign In for Pricing
View Details
SLC17A7 Antibody
MBS8595962-03 0.1 mL (AF405S)

SLC17A7 Antibody

Sign In for Pricing
View Details
SLC17A7 Antibody
MBS8595962-04 0.1 mL (AF610)

SLC17A7 Antibody

Sign In for Pricing
View Details