Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus ATP synthase subunit a 1 (atpB1)

This Recombinant Pelobacter propionicus ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

A1ALL0

Expression Region

1-229

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPLLFLEFFRKLLEPLHMSEAGADAVAYTWLIMLLLLLFSFLATRALKMIPCGLQNFM EVVVGGVENMIVETMGEHGRPYFPLVATVGLFVLVSNLIGLIPGFFPPTANINTTAACAI VVFIATHVVGIKRHGIGYIKHFCGPILWLAPVMFFIEVIGHLSRPLSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mianserin HCl
A1796-5.1 10 mM (in 1mL DMSO)

Mianserin HCl

Sign In for Pricing
View Details
Litvay Medium, w/ Vitamins
30630049-3 25 L

Litvay Medium, w/ Vitamins

Sign In for Pricing
View Details
STON1-GTF2A1L siRNA Oligos set (Human)
45764171 3x 5 nmol

STON1-GTF2A1L siRNA Oligos set (Human)

Sign In for Pricing
View Details
STX12 Rabbit Polyclonal Antibody
55450-01 50 µL

STX12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STX12 Rabbit Polyclonal Antibody
55450-02 100 µL

STX12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 6 (CLDN6) Antibody (HRP)
abx335127-01 20 µg

Claudin 6 (CLDN6) Antibody (HRP)

Sign In for Pricing
View Details