Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus ATP synthase subunit a 3 (atpB3)

This Recombinant Pelobacter propionicus ATP synthase subunit a 3 (atpB3) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a 3, ATP synthase F0 sector subunit a 3, F-ATPase subunit 6 3

UniProt

A1AP45

Expression Region

1-229

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPFLFLEFLRKMLAPLHLSEASADAVSYTWLIIALLLLLSFLATRALKTVPGGLQNFM EIIVGGIENMVTETMGEHGRPYFPLVATIGIFVLVSNLIGLIPGFFPPTANINTTAACAI VVFLSTHVVGIKRHGIGYIKHFCGPILWLTPIMFFIEVIGHLSRPVSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha Synuclein (SNCA) (C-term) Rabbit Polyclonal Antibody
AP13472PU-N 400 µL

alpha Synuclein (SNCA) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4Alpha-Hydroxy Cholesterol
TRC-H917975-5MG 5 mg

4Alpha-Hydroxy Cholesterol

Sign In for Pricing
View Details
EGR1 (+EGR2) Rabbit Polyclonal Antibody
AP06678PU-N 100 µg

EGR1 (+EGR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Oxaloacetic Acid-13C4
TRC-O845032-5MG 5 mg

Oxaloacetic Acid-13C4

Sign In for Pricing
View Details
FSH Receptor (FSHR) Rabbit Polyclonal Antibody
AP01215PU-N 100 µg

FSH Receptor (FSHR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Papaveroxine
TRC-P190520-10MG 10 mg

Papaveroxine

Sign In for Pricing
View Details