Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter bemidjiensis ATP synthase subunit a (atpB)

This Recombinant Geobacter bemidjiensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B5EFG8

Expression Region

1-229

Origin

Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPYLFLNFFRELLHPLGFSEAGADAVVYTWLIMIGLVVLSIAATKRLQAVPSGLQNFM EVIVGGIENMLVETMGEHGKPFFPLVATLALFILVSNLIGLVPGFFPPTANINTTAACAV VVFVTTHIVGVKHHGAGYIKHFLGPIAWLAPMMFFIEVIGHLSRVISLTLRLFGNMNGHE LVLIIFFGLAPFIVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEHAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plaur Mouse Gene Knockout Kit (CRISPR)
KN313408 1 Kit

Plaur Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PUS3 (N-term) Rabbit Polyclonal Antibody
AP53522PU-N 400 µL

PUS3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPEM1 (NM_199339) Human Over-expression Lysate
LC404309 20 µg

SPEM1 (NM_199339) Human Over-expression Lysate

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-01 50 μL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-02 100 µL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-03 1 mL

WAPL Antibody

Sign In for Pricing
View Details