Recombinant Geobacter sp. ATP synthase subunit a (atpB)
This Recombinant Geobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-229.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
B9LZL3
Expression Region
1-229
Origin
Geobacter sp. (strain FRC-32)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVHPFLFLQFFRHLLTPLGISEGGADAIAYTWLIIALLLIVSILATKGLKSVPGKMQNFM EVIIGGIENMVVETMGEHGKPFFPLIATLALFILVSNLIGLIPGFFPPTANINTTAACAV IVFVTTHIVGIKEHGVKYIKHFLGPILWLAPMMFFIEVIGHFSRVISLTLRLFGNMNGHE LVLMIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEGH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC943792-100 1x 100 µL
Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880868-100 1x 100 µL
Golgi Complex (AE-6), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details