Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sp. ATP synthase subunit a (atpB)

This Recombinant Geobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B9LZL3

Expression Region

1-229

Origin

Geobacter sp. (strain FRC-32)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPFLFLQFFRHLLTPLGISEGGADAIAYTWLIIALLLIVSILATKGLKSVPGKMQNFM EVIIGGIENMVVETMGEHGKPFFPLIATLALFILVSNLIGLIPGFFPPTANINTTAACAV IVFVTTHIVGIKEHGVKYIKHFLGPILWLAPMMFFIEVIGHFSRVISLTLRLFGNMNGHE LVLMIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB525797 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR560568 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Annexin V-EGFP/PI Apoptosis Kit
E-CK-A219-01 20 Assays

Annexin V-EGFP/PI Apoptosis Kit

Sign In for Pricing
View Details
Annexin V-EGFP/PI Apoptosis Kit
E-CK-A219-02 100 Assays

Annexin V-EGFP/PI Apoptosis Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, left
CS715137 5x 5 µm

Tissue FFPE Sections, Breast, left

Sign In for Pricing
View Details
Fucose BSA Colloidal Gold Conjugate,  10nm
CCG-0004-10 1 mL

Fucose BSA Colloidal Gold Conjugate, 10nm

Sign In for Pricing
View Details