Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sp. ATP synthase subunit a (atpB)

This Recombinant Geobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B9LZL3

Expression Region

1-229

Origin

Geobacter sp. (strain FRC-32)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPFLFLQFFRHLLTPLGISEGGADAIAYTWLIIALLLIVSILATKGLKSVPGKMQNFM EVIIGGIENMVVETMGEHGKPFFPLIATLALFILVSNLIGLIPGFFPPTANINTTAACAV IVFVTTHIVGIKEHGVKYIKHFLGPILWLAPMMFFIEVIGHFSRVISLTLRLFGNMNGHE LVLMIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ileum
CS508814 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-01 50 μL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-02 100 µL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-03 1 mL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
SLC25A20 Rabbit Polyclonal Antibody
TA371517 100 µL

SLC25A20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAB3A (NM_002866) Human Recombinant Protein
TP303973M 100 µg

RAB3A (NM_002866) Human Recombinant Protein

Sign In for Pricing
View Details