Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Electron transport complex protein RnfE (rnfE)

This Recombinant Salmonella enteritidis PT4 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B5QV05

Expression Region

1-230

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Unconjugated Rabbit Anti-SJA Antibody
AL-2901-2 2 mL

Unconjugated Rabbit Anti-SJA Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/834), 0.2mg/mL
BNUB0834-500 1x 500 µL

Cytokeratin 18 (KRT18/834), 0.2mg/mL

Sign In for Pricing
View Details
(R)-(-)-2-Amino-1-butanol
TRC-A602205-500MG 500 mg

(R)-(-)-2-Amino-1-butanol

Sign In for Pricing
View Details
Chlamydia TaqMan PCR Kit
TM31450 100 Reactions

Chlamydia TaqMan PCR Kit

Sign In for Pricing
View Details
POLD1 Human Gene Knockout Kit (CRISPR)
KN201238RB 1 Kit

POLD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF568 conjugate, 0.1mg/mL
BNC680688-100 1x 100 µL

Cytokeratin 8 (C-43), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details