Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia fergusonii Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia fergusonii Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B7LQN8

Expression Region

1-230

Origin

Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR RWTPTEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFAIGMGATGAMFVLGAMREIIGNGTLFDGADALLGNWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRAKTVVNEIPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aphidicolin
SIH-605-1MG 1 mg

Aphidicolin

Sign In for Pricing
View Details
EHD3 (NM_014600) Human Over-expression Lysate
LC402352 20 µg

EHD3 (NM_014600) Human Over-expression Lysate

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF647 conjugate, 0.1mg/mL
BNC471082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human JMY activation kit by CRISPRa
GA115208 1 Kit

Human JMY activation kit by CRISPRa

Sign In for Pricing
View Details
Bovine Interleukin 5 (IL5) ELISA Kit
RD-IL5-b-01 96 Tests

Bovine Interleukin 5 (IL5) ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin 5 (IL5) ELISA Kit
RD-IL5-b-02 48 Tests

Bovine Interleukin 5 (IL5) ELISA Kit

Sign In for Pricing
View Details