Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio splendidus Electron transport complex protein RnfE (rnfE)

This Recombinant Vibrio splendidus Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B7VLT3

Expression Region

1-230

Origin

Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDHKTLIKNGMWANNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVSVSLVR NHVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNEVLPAAQDGFWMGLGMTSVLVVLGAMREIIGNGTLFDGADLLLGDWASVLRIQIFQFD NSFLLALLPPGAFIGVGFLIALKNIIDNQAKSRQPKQEKPVIERARVTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fructosyl Glycine Alpha/Beta Mixture (Mixture of Diastereomers)
TRC-F795750-10MG 10 mg

Fructosyl Glycine Alpha/Beta Mixture (Mixture of Diastereomers)

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), Biotin conjugate, 0.1mg/mL
BNCB2432-500 1x 500 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-7988-01 50 μL

DNAJB1 Antibody

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-7988-02 100 µL

DNAJB1 Antibody

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-7988-03 1 mL

DNAJB1 Antibody

Sign In for Pricing
View Details
Ces2f Mouse Gene Knockout Kit (CRISPR)
KN503198 1 Kit

Ces2f Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details