Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio splendidus Electron transport complex protein RnfE (rnfE)

This Recombinant Vibrio splendidus Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B7VLT3

Expression Region

1-230

Origin

Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDHKTLIKNGMWANNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVSVSLVR NHVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNEVLPAAQDGFWMGLGMTSVLVVLGAMREIIGNGTLFDGADLLLGDWASVLRIQIFQFD NSFLLALLPPGAFIGVGFLIALKNIIDNQAKSRQPKQEKPVIERARVTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS501102 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Neptune Filter Tips 20-300 µL Universal Fit Racked, Low Retention, Pre-Sterilized
BT300 96 Tips/Rack - 10 Racks/PK

Neptune Filter Tips 20-300 µL Universal Fit Racked, Low Retention, Pre-Sterilized

Sign In for Pricing
View Details
Human TRIB3 activation kit by CRISPRa
GA111723 1 Kit

Human TRIB3 activation kit by CRISPRa

Sign In for Pricing
View Details
COX7A2 (NM_001865) Human Over-expression Lysate
LY419693 100 µg

COX7A2 (NM_001865) Human Over-expression Lysate

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), 1mg/mL
BNUM0015-50 1x 50 µL

CD56 / NCAM (123C3.D5), 1mg/mL

Sign In for Pricing
View Details
RDX Antibody
8C18143-AAT 50 µg

RDX Antibody

Sign In for Pricing
View Details