Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Electron transport complex protein RnfE (rnfE)

This Recombinant Salmonella paratyphi C Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

C0Q511

Expression Region

1-230

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNRD1 Recombinant Rabbit Monoclonal Antibody [JA11-32]
ET1704-81 100 µL

TXNRD1 Recombinant Rabbit Monoclonal Antibody [JA11-32]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS701633 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
NMDAR2A (GRIN2A) Rabbit Monoclonal Antibody
TA423171 100 µL

NMDAR2A (GRIN2A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626583 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human NSE Antibody Pair Set
E-KAB-0059 50 µL & 100 µg

Human NSE Antibody Pair Set

Sign In for Pricing
View Details
Transthyretin (Prealbumin) (CPTC-TTR-1), CF594 conjugate, 0.1mg/mL
BNC942249-100 1x 100 µL

Transthyretin (Prealbumin) (CPTC-TTR-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details