Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Cobalamin synthase (cobS)

This Recombinant Pyrococcus horikoshii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

O58111

Expression Region

1-230

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNILPFLTRIPIKGDFEKARRELWAFPLVSVFTSPLPALILYLKVPLASILALLSLYFT IGLLHLDGLADWADGIMVKGDREKKIKAMKDINVGVAGIFAVVTVLMLQIYSLQLVPFYA IFLAELNSKFAMLLAMATKKPLGKGLGAYFMEALDRNQLLYGTLIYLLLYIPVIIAEPRN LVSFLGLFIGLYAVKISLDNFGGLNGDCIGAVAEITRVGTLVVITLGWRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chrysin 7-O-neohesperidoside
orb1680394 5 mg

Chrysin 7-O-neohesperidoside

Sign In for Pricing
View Details
Phospho-MDM2 (Ser166) Rabbit Polyclonal Antibody (PE-Cy7)
orb903147 100 µL

Phospho-MDM2 (Ser166) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Hsa-miR-3144-5p mimic
HY-R00587-01 5 nmol

Hsa-miR-3144-5p mimic

Sign In for Pricing
View Details
Hsa-miR-3144-5p mimic
HY-R00587-02 20 nmol

Hsa-miR-3144-5p mimic

Sign In for Pricing
View Details
Phyperunolide E
YXB40052-01 5 mg

Phyperunolide E

Sign In for Pricing
View Details
Phyperunolide E
YXB40052-02 10 mg

Phyperunolide E

Sign In for Pricing
View Details