Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Asterina pectinifera ATP synthase subunit a (ATP6)

This Recombinant Asterina pectinifera ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q33823

Expression Region

1-230

Origin

Asterina pectinifera (Starfish) (Patiria pectinifera)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNLNSIFGQFSPDLVLFIPMTLTAVFLNLSWLSISNPSNWLPSRANLLILSFYQEVLK ILFQQTNPNTAPWVSAFTAIFILIFSINVLGLLPYAFTSTSHISLTYSIGVPLWMSVNIL GFYLAFNSRLGHLVPQGTPSYLIPFMVIIETISLFAQPIALGLRLAANLTAGHLLIFLLS TAIWTLSSSPSIASITLLIFFFLFLLEIGVACIQAYVFTALVNFYLSQNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPT2 (NM_000098) Human Over-expression Lysate
LY424932 100 µg

CPT2 (NM_000098) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate
LC400062 20 µg

alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), 0.2mg/mL
BNUB2498-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), 0.2mg/mL

Sign In for Pricing
View Details
Multi-Well Plate
KF05US-9-N 50 Pack/Case

Multi-Well Plate

Sign In for Pricing
View Details
4-Amino-6-hydroxy-1,3-benzenedicarboxylic Acid
TRC-A634570-5MG 5 mg

4-Amino-6-hydroxy-1,3-benzenedicarboxylic Acid

Sign In for Pricing
View Details
SLC26A6 Goat Polyclonal Antibody
AP32055PU-N 100 µg

SLC26A6 Goat Polyclonal Antibody

Sign In for Pricing
View Details