Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Asterina pectinifera ATP synthase subunit a (ATP6)

This Recombinant Asterina pectinifera ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q33823

Expression Region

1-230

Origin

Asterina pectinifera (Starfish) (Patiria pectinifera)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNLNSIFGQFSPDLVLFIPMTLTAVFLNLSWLSISNPSNWLPSRANLLILSFYQEVLK ILFQQTNPNTAPWVSAFTAIFILIFSINVLGLLPYAFTSTSHISLTYSIGVPLWMSVNIL GFYLAFNSRLGHLVPQGTPSYLIPFMVIIETISLFAQPIALGLRLAANLTAGHLLIFLLS TAIWTLSSSPSIASITLLIFFFLFLLEIGVACIQAYVFTALVNFYLSQNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD45RA (C-6His)
PKSH034053-01 10 µg

Recombinant Human CD45RA (C-6His)

Sign In for Pricing
View Details
Recombinant Human CD45RA (C-6His)
PKSH034053-02 50 µg

Recombinant Human CD45RA (C-6His)

Sign In for Pricing
View Details
Rat Cholinergic Receptor, Nicotinic, Alpha 1 (CHRNa1) ELISA Kit
RDR-CHRNa1-Ra-01 96 Tests

Rat Cholinergic Receptor, Nicotinic, Alpha 1 (CHRNa1) ELISA Kit

Sign In for Pricing
View Details
Rat Cholinergic Receptor, Nicotinic, Alpha 1 (CHRNa1) ELISA Kit
RDR-CHRNa1-Ra-02 48 Tests

Rat Cholinergic Receptor, Nicotinic, Alpha 1 (CHRNa1) ELISA Kit

Sign In for Pricing
View Details
SNCα/α-Synuclein Polyclonal Antibody
E-AB-40579-01 25 µL

SNCα/α-Synuclein Polyclonal Antibody

Sign In for Pricing
View Details
SNCα/α-Synuclein Polyclonal Antibody
E-AB-40579-02 100 µL

SNCα/α-Synuclein Polyclonal Antibody

Sign In for Pricing
View Details