Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Asterina pectinifera ATP synthase subunit a (ATP6)

This Recombinant Asterina pectinifera ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q33823

Expression Region

1-230

Origin

Asterina pectinifera (Starfish) (Patiria pectinifera)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNLNSIFGQFSPDLVLFIPMTLTAVFLNLSWLSISNPSNWLPSRANLLILSFYQEVLK ILFQQTNPNTAPWVSAFTAIFILIFSINVLGLLPYAFTSTSHISLTYSIGVPLWMSVNIL GFYLAFNSRLGHLVPQGTPSYLIPFMVIIETISLFAQPIALGLRLAANLTAGHLLIFLLS TAIWTLSSSPSIASITLLIFFFLFLLEIGVACIQAYVFTALVNFYLSQNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB25 Polyclonal Antibody
E-AB-11512-01 20 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-11512-02 60 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-11512-03 120 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-11512-04 200 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details
GRB7 Polyclonal Antibody
E-AB-14108-01 20 µL

GRB7 Polyclonal Antibody

Sign In for Pricing
View Details
GRB7 Polyclonal Antibody
E-AB-14108-02 60 µL

GRB7 Polyclonal Antibody

Sign In for Pricing
View Details