Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Androgen-dependent TFPI-regulating protein (Adtrp)

This Recombinant Mouse Androgen-dependent TFPI-regulating protein (Adtrp) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Androgen-dependent TFPI-regulating protein

UniProt

Q8C138

Expression Region

1-230

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKTTTCVYHFLVLNWYIFLNYHIPQIGRNEEKLREFHDGGRSKYLTLLNLLLQAIFFGV ACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDD FFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYVQTGNW VYPVFDSLSPLGIIIFFSAAYILVAGIYLFGEKINHWKWGAIAKPQMKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HTRA1 Antibody Pair Set
E-KAB-0499 50 µL & 100 µg

Human HTRA1 Antibody Pair Set

Sign In for Pricing
View Details
THBS4 Antibody
8C19108-AAT 50 µg

THBS4 Antibody

Sign In for Pricing
View Details
Ethyl 3-Bromopyruvate
TRC-E900540-25G 25 g

Ethyl 3-Bromopyruvate

Sign In for Pricing
View Details
MTRNR2L5 Human Gene Knockout Kit (CRISPR)
KN430905 1 Kit

MTRNR2L5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BTF3 (NM_001037637) Human Over-expression Lysate
LC421972 20 µg

BTF3 (NM_001037637) Human Over-expression Lysate

Sign In for Pricing
View Details
Diallyl Disulphide (Technical grade, >80%)
TRC-D416035-1G 1 g

Diallyl Disulphide (Technical grade, >80%)

Sign In for Pricing
View Details