Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter lovleyi ATP synthase subunit a (atpB)

This Recombinant Geobacter lovleyi ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B3E9X3

Expression Region

1-230

Origin

Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHPLLFLQFLSTKLQHLLHISDASANAVVYTWTVIVLLLVLSLIATRALKTIPSGVQNF MEVVVDGIENMIVETMGEHGRSFFPLIATLAIFILVSNLVGLIPGFYPPTANVNTTAACA IVVFLATHVVGIKHHGFHYLKHFMGPIWWLAPLMFFIEVIGHLSRPVSLTLRLFGNMNGH ELVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBP501 Affinity Peptide
H-8214.0001 1.0mg

CBP501 Affinity Peptide

Sign In for Pricing
View Details
Rat Actin Filament Associated Protein 1 ELISA Kit
MBS729899-01 48 Well

Rat Actin Filament Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Actin Filament Associated Protein 1 ELISA Kit
MBS729899-02 96 Well

Rat Actin Filament Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Actin Filament Associated Protein 1 ELISA Kit
MBS729899-03 5x 96 Well

Rat Actin Filament Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Actin Filament Associated Protein 1 ELISA Kit
MBS729899-04 10x 96 Well

Rat Actin Filament Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis Recombination protein RecR (recR)
MBS1330497-01 0.02 mg (E-Coli)

Recombinant Idiomarina loihiensis Recombination protein RecR (recR)

Sign In for Pricing
View Details