Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yohK (yohK)

This Recombinant Inner membrane protein yohK (yohK) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Inner membrane protein yohK

UniProt

P0AD20

Expression Region

1-231

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMANIWWSLPLTLIVFFAARKLAARYKFPLLNPLLVAMVVIIPFLMLTGISYDSYFKGSE VLNDLLQPAVVALAYPLYEQLHQIRARWKSIITICFIGSVVAMVTGTSVALLMGASPEIA ASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIRTKAARGLA MGTASHALGTARCAELDYQEGAFSSLALVLCGIITSLIAPFLFPIILAVMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAVS Recombinant Rabbit Monoclonal Antibody [PSH01-65]
HA721708 100 µL

MAVS Recombinant Rabbit Monoclonal Antibody [PSH01-65]

Sign In for Pricing
View Details
Norastemizole Hydrobromide
TRC-N661060-50MG 50 mg

Norastemizole Hydrobromide

Sign In for Pricing
View Details
PTEN Antibody
KC-4168-01 50 μL

PTEN Antibody

Sign In for Pricing
View Details
PTEN Antibody
KC-4168-02 100 µL

PTEN Antibody

Sign In for Pricing
View Details
PTEN Antibody
KC-4168-03 1 mL

PTEN Antibody

Sign In for Pricing
View Details
Recombinant Human SUMO2 Protein (His Tag)
PKSH033067-01 10 µg

Recombinant Human SUMO2 Protein (His Tag)

Sign In for Pricing
View Details