Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfE (rnfE)

This Recombinant Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A1ABH7

Expression Region

1-231

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFRTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS639015 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
TentaGel® HL AC
HL12011.50G 50 g

TentaGel® HL AC

Sign In for Pricing
View Details
Bisphenol B Mono-Beta-D-glucuronide
TRC-B519463-2.5MG 2.5 mg

Bisphenol B Mono-Beta-D-glucuronide

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF405S conjugate, 0.1mg/mL
BNC043293-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP3R2 (NM_147180) Human Recombinant Protein
TP305406M 100 µg

PPP3R2 (NM_147180) Human Recombinant Protein

Sign In for Pricing
View Details
Porcine Apolipoprotein A1 (APOA1) ELISA Kit
RDR-APOA1-p-01 96 Tests

Porcine Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details