Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfE (rnfE)

This Recombinant Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A1ABH7

Expression Region

1-231

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFRTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)
MBS1385057-01 0.05 mg (E-Coli)

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)
MBS1385057-02 0.05 mg (Yeast)

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)
MBS1385057-03 0.2 mg (E-Coli)

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)
MBS1385057-04 0.5 mg (E-Coli)

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)
MBS1385057-05 0.05 mg (Baculovirus)

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)
MBS1385057-06 0.2 mg (Yeast)

Recombinant Zymomonas mobilis subsp. pomaceae N-(5'-phosphoribosyl) anthranilate isomerase (trpF)

Sign In for Pricing
View Details