Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B1XFU4

Expression Region

1-231

Origin

Escherichia coli (strain K12 / DH10B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,4-Dichlorobenzyl bromide
TRC-D436523-500MG 500 mg

3,4-Dichlorobenzyl bromide

Sign In for Pricing
View Details
IP3KC Antibody
8C11487-AAT 50 µg

IP3KC Antibody

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/3393), CF488A conjugate, 0.1mg/mL
BNC883393-100 1x 100 µL

Drebrin 1 (DBN1) (DBN1/3393), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-Hydroxyquinoline Copper Salt
TRC-H953268-5G 5 g

8-Hydroxyquinoline Copper Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800223 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
ERK1 / ERK2 (N-term) Rabbit Polyclonal Antibody
AP23276PU-N 100 µg

ERK1 / ERK2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details