Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 18 Electron transport complex protein RnfE (rnfE)

This Recombinant Shigella boydii serotype 18 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B2U2D1

Expression Region

1-231

Origin

Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bola2 (NM_175103) Mouse Tagged ORF Clone
MG200189 10 µg

Bola2 (NM_175103) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS710546 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF568 conjugate, 0.1mg/mL
BNC681386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,4-Dichloroquinoline
TRC-D436225-25G 25 g

2,4-Dichloroquinoline

Sign In for Pricing
View Details
KDM3A / JHDM2A (KDM3A) (NM_001146688) Human Over-expression Lysate
LC432099 20 µg

KDM3A / JHDM2A (KDM3A) (NM_001146688) Human Over-expression Lysate

Sign In for Pricing
View Details
ZBTB43 (NM_001135776) Human Over-expression Lysate
LC427708 20 µg

ZBTB43 (NM_001135776) Human Over-expression Lysate

Sign In for Pricing
View Details