Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B7NU01

Expression Region

1-231

Origin

Escherichia coli O7:K1 (strain IAI39 / ExPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRLEIFHTD SPFLLAMLPPSAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HSPA4/Heat shock 70 kDa protein 4 ELISA Kit
E1178Hu 96 Tests

Human HSPA4/Heat shock 70 kDa protein 4 ELISA Kit

Sign In for Pricing
View Details
CD300LF (aa 18-290) Specific Recomb™ Antibody (V3S-0324-FY36), Human IgG1
V3S-0324-FY36 Each

CD300LF (aa 18-290) Specific Recomb™ Antibody (V3S-0324-FY36), Human IgG1

Sign In for Pricing
View Details
Human Glucokinase (GCK) ELISA Kit
NSL0586Hu 96 Tests

Human Glucokinase (GCK) ELISA Kit

Sign In for Pricing
View Details
Vps11 (NM_001108138) Rat Tagged Lenti ORF Clone
RR208042L4 10 µg

Vps11 (NM_001108138) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human protein Red, IK ELISA Kit
MBS707208-01 24 Well (LIMIT 1)

Human protein Red, IK ELISA Kit

Sign In for Pricing
View Details
Human protein Red, IK ELISA Kit
MBS707208-02 48 Well

Human protein Red, IK ELISA Kit

Sign In for Pricing
View Details