Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfE (rnfE)
This Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfE
UniProt
B7NU01
Expression Region
1-231
Origin
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRLEIFHTD SPFLLAMLPPSAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
130424-PE 100 µL
NME3 (Nucleoside Diphosphate Kinase C, NDPKC, NDPK-C, c371H6.2, DR-nm23, KIAA0516, Nucleoside Diphosphate Kinase 3, NDP Kinase 3, NDK 3, NDK3, NM23H3, nm23-H3) (PE)
Sign In for Pricing
View Details 
K3324804 1.0 µg DNA
CK137956 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 43940066 1.0 µg DNA
SLC22A14 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 