Recombinant Escherichia coli O45:K1 Electron transport complex protein RnfE (rnfE)
This Recombinant Escherichia coli O45:K1 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfE
UniProt
B7M9Y6
Expression Region
1-231
Origin
Escherichia coli O45:K1 (strain S88 / ExPEC)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFRTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details