Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O17:K52:H18 Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli O17:K52:H18 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B7NB86

Expression Region

1-231

Origin

Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-500 1x 500 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details