Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B1LEQ4

Expression Region

1-231

Origin

Escherichia coli (strain SMS-3-5 / SECEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMCVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JPH3 (NM_020655) Human Over-expression Lysate
LY402798 100 µg

JPH3 (NM_020655) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CLEC2A activation kit by CRISPRa
GA117913 1 Kit

Human CLEC2A activation kit by CRISPRa

Sign In for Pricing
View Details
Tex29 Mouse Gene Knockout Kit (CRISPR)
KN517444 1 Kit

Tex29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP5O Recombinant Rabbit monoclonal Antibody
HA751542 100 µL

ATP5O Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MSX1 (NM_002448) Human Over-expression Lysate
LY400873 100 µg

MSX1 (NM_002448) Human Over-expression Lysate

Sign In for Pricing
View Details
m-Salicylic Acid
TRC-S088105-5G 5 g

m-Salicylic Acid

Sign In for Pricing
View Details